Haloferax volcanii wsp1: G3A49_15585 Help Entry G3A49_15585       CDS       T06450                                  Name (GenBank) acc operon protein   KO K22568   acetyl-CoA/propionyl-CoA carboxylase, PccX subunit [EC:6.4.1.2 6.4.1.3] Organism hale  Haloferax volcanii wsp1 Pathway hale00280   Valine, leucine and isoleucine degradation hale00630   Glyoxylate and dicarboxylate metabolism hale00640   Propanoate metabolism hale01100   Metabolic pathways hale01110   Biosynthesis of secondary metabolites hale01120   Microbial metabolism in diverse environments hale01200   Carbon metabolism Module hale_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:hale00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     G3A49_15585    00640 Propanoate metabolism     G3A49_15585   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     G3A49_15585 Enzymes [BR:hale01000]  6. Ligases   6.4  Forming carbon-carbon bonds    6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)     6.4.1.2  acetyl-CoA carboxylase      G3A49_15585     6.4.1.3  propionyl-CoA carboxylase      G3A49_15585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TEX13B-like_middle Motif Other DBs NCBI-ProteinID:  QIB79452 UniProt:  A0A6C0UVD9 LinkDB All DBs Position 3159116..3159385 Genome browser AA seq 89 aa AA seqDB search MSGELLSGLSIPDDADAEEAAAIAAAVGAHLHDQSVAAAAAAAGDGEETWNEERWRYAGR LESVTGCGHRVPSGAPTDAWTASGRVDRF NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcggcgaactgctgtcggggctgtcgattccggacgacgccgacgccgaggaggcc gcggccatcgccgccgccgtcggcgcgcacctccacgaccagtcggtcgccgcggccgcc gcggccgcaggggacggcgaggagacgtggaacgaggagcgctggcggtacgccggccgc ctcgaatcggtcacgggctgtggccaccgcgtcccctccggcgcgccgaccgacgcgtgg accgcctcgggccgcgtcgaccggttctga

DBGET integrated database retrieval system