Halomonas alkaliantarctica: QEN58_18435
Help
Entry
QEN58_18435 CDS
T09033
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
half
Halomonas alkaliantarctica
Pathway
half02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
half00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
QEN58_18435 (phnC)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
half02000
]
QEN58_18435 (phnC)
Enzymes [BR:
half01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
QEN58_18435 (phnC)
Transporters [BR:
half02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
QEN58_18435 (phnC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
AAA_29
AAA_16
RsgA_GTPase
AAA_23
AAA_27
AAA_22
AAA_30
NB-ARC
nSTAND1
Mg_chelatase
Zeta_toxin
nSTAND3
PRK
Motif
Other DBs
NCBI-ProteinID:
WGI25282
UniProt:
A0ABY8LNV0
LinkDB
All DBs
Position
4021888..4022685
Genome browser
AA seq
265 aa
AA seq
DB search
MLEITNLVKRYGHDEAVLKGLDLKVEGNSVVSIVGASGAGKSTMLRCINRLVEPTSGSIK
LNGNELVNLKGAELRRARRKIGMVFQGFNLLDRLTVMENVLAGRLGYVNLYQAISRRYPQ
GDIERAFVLMERVGIAHYANKRADELSGGERQRVGVVRALMQEPEVLLADEPTASLDPRT
SEQIMILLQSLASELSLPVLINIHNVAQAKTYTERIVGLRHGKMIFDGLPADFNKDALDA
IYGGIEAPDDAITDTPVEERSHDSA
NT seq
798 nt
NT seq
+upstream
nt +downstream
nt
atgctggaaattaccaatctggtcaaacgttatggccacgatgaagccgtgctgaaaggg
cttgacctcaaggtagagggaaacagcgttgtttctatcgtaggcgcctcgggtgcgggt
aaaagcaccatgctgagatgtatcaatcgcctggtcgagccgacttcgggctcgatcaaa
ctcaacggcaatgagctggtcaacctgaaaggcgctgaattacgccgcgcgcgccgcaaa
attggcatggtgttccagggatttaacctgctggatcgcttaaccgtgatggagaacgta
ctggccgggcggttgggttacgtcaatctctatcaagcaatttcacgtcgttacccccag
ggcgatattgagcgtgcctttgtactgatggagcgcgtgggaatagcccactacgccaac
aagcgcgctgatgagctttcgggcggcgagcggcagcgggtaggcgtggttcgcgcactg
atgcaggaacctgaagtgctgctggctgatgaaccgactgcctcgctggatccacgcact
tccgagcaaatcatgatattgctgcagagcttggccagcgagctgtcgttgccggtgctg
attaatatccacaacgttgcacaggccaaaacctataccgagcggattgtgggtctacgc
cacggtaagatgatctttgatgggttgcctgccgatttcaacaaagacgcgttagacgct
atctacggcggcattgaagcaccggacgatgcgattaccgatacgcccgtggaggagcgc
tcccatgactccgcctga
DBGET
integrated database retrieval system