Halodesulfurarchaeum formicicum HTSR1: HTSR_1176
Help
Entry
HTSR_1176 CDS
T04517
Name
(GenBank) NADH-quinone oxidoreductase subunit J
KO
K00339
NADH-quinone oxidoreductase subunit J [EC:
7.1.1.2
]
Organism
halh
Halodesulfurarchaeum formicicum HTSR1
Pathway
halh00190
Oxidative phosphorylation
halh01100
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:
halh00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
HTSR_1176
Enzymes [BR:
halh01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
HTSR_1176
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Oxidored_q3
MbhD
Motif
Other DBs
NCBI-ProteinID:
AOW80356
UniProt:
A0A1D8S4S5
LinkDB
All DBs
Position
complement(1113073..1113330)
Genome browser
AA seq
85 aa
AA seq
DB search
MIEQLTFLLFALFTVGSSLGVVLVDDVWHSALFLGAALLSVAVHFLLLKAAFLAAVQVLV
YVGGVLILIAFAVMLTRDPDGGVGA
NT seq
258 nt
NT seq
+upstream
nt +downstream
nt
atgatcgagcaactcaccttcctcctcttcgcgctgttcacggtcggcagcagtctgggc
gtggtcctcgtggacgacgtctggcactctgccctcttcctcggggctgcactgctcagt
gtcgccgtgcacttcctgctcctgaaggccgccttcctcgcggccgtacaggtgctggtc
tacgtgggcggcgtgctgatcctgatcgccttcgcggtcatgctgacccgcgatcctgac
ggaggtgttggcgcatga
DBGET
integrated database retrieval system