Haloarcula sp. JP-L23: G9465_01895 Help Entry G9465_01895       CDS       T06489                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism halj  Haloarcula sp. JP-L23 Pathway halj03010   Ribosome Brite KEGG Orthology (KO) [BR:halj00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     G9465_01895   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     G9465_01895  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:halj03011]     G9465_01895    04121 Ubiquitin system [BR:halj04121]     G9465_01895   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:halj04147]     G9465_01895 Ribosome [BR:halj03011]  Ribosomal proteins   Eukaryotes    Small subunit     G9465_01895   Archaea     G9465_01895 Ubiquitin system [BR:halj04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    G9465_01895 Exosome [BR:halj04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    G9465_01895   Exosomal proteins of colorectal cancer cells    G9465_01895 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Zn_ribbon_RPB9 Zn_ribbon_3 DZR Zn_ribbon_RPAB4 Auto_anti-p27 Zn-ribbon_GIR1 DUF8054_C Cas12f1-like_TNB HypA CHP02642 zf-C2H2_FBX41 Zn_Ribbon_TF Motif Other DBs NCBI-ProteinID:  QIO21173 LinkDB All DBs Position 395144..395275 Genome browser AA seq 43 aa AA seqDB search MARNEYYEDGELVKENCPRCGDTVLADHDDRKHCGKCGYTEWK NT seq 132 nt NT seq  +upstreamnt  +downstreamnt atggcccgcaacgagtactacgaggacggcgaactggtcaaggagaactgcccgcgctgc ggtgacacggtgctggccgaccacgacgaccgcaagcactgcggcaagtgcggctacacc gagtggaagtaa

DBGET integrated database retrieval system