Vreelandella alkaliphila: CUU95_13200 Help Entry CUU95_13200       CDS       T05720                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism halk  Vreelandella alkaliphila Pathway halk02024   Quorum sensing halk03018   RNA degradation Brite KEGG Orthology (KO) [BR:halk00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     CUU95_13200  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     CUU95_13200  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:halk03019]     CUU95_13200    03036 Chromosome and associated proteins [BR:halk03036]     CUU95_13200 Messenger RNA biogenesis [BR:halk03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      CUU95_13200 Chromosome and associated proteins [BR:halk03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     CUU95_13200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AYF34707 LinkDB All DBs Position 2924843..2925091 Genome browser AA seq 82 aa AA seqDB search MSKGQSLQDPYLNILRKERIPVSIFLVNGIKLQGQIESFDQFVILLRNTVSQMVYKHAIS TVVPSRNVRLPAQDPAAPDADI NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtccaaagggcagtcccttcaagacccgtacctgaacattttgcgcaaggagcgcatt ccggtctctattttcctggtgaacggcattaaattgcagggccagattgaatcatttgac cagtttgtcattttattgcgcaataccgtcagtcagatggtttataaacacgctatttcc acggtagtgccttcgcgcaacgtgcgtttgccggcacaagatccagccgcgcccgacgcg gacatctaa

DBGET integrated database retrieval system