Vreelandella alkaliphila: CUU95_13740 Help Entry CUU95_13740       CDS       T05720                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism halk  Vreelandella alkaliphila Pathway halk01100   Metabolic pathways halk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:halk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CUU95_13740    00074 Mycolic acid biosynthesis     CUU95_13740   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CUU95_13740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  AYF34810 LinkDB All DBs Position 3036692..3036925 Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQNSSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYVNAHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtactattgaagagcgcgttaagaaagttgtggcagagcgcctgaacgttaaagaa gaagatatccagaatagctcttcttttactgaagacctgggtgctgattctcttgacacc gttgaactggtgatggcgcttgaagaggaatttgatactgaaattcctgacgaagaagct gaaaaaatcaccacggttcaagaagctatcgactacgtaaacgcccatcagtaa

DBGET integrated database retrieval system