Haloprofundus sp. MHR1: FCF25_04495 Help Entry FCF25_04495       CDS       T05952                                  Name (GenBank) acc operon protein   KO K22568   acetyl-CoA/propionyl-CoA carboxylase, PccX subunit [EC:6.4.1.2 6.4.1.3] Organism halm  Haloprofundus sp. MHR1 Pathway halm00280   Valine, leucine and isoleucine degradation halm00630   Glyoxylate and dicarboxylate metabolism halm00640   Propanoate metabolism halm01100   Metabolic pathways halm01110   Biosynthesis of secondary metabolites halm01120   Microbial metabolism in diverse environments halm01200   Carbon metabolism Module halm_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:halm00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     FCF25_04495    00640 Propanoate metabolism     FCF25_04495   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     FCF25_04495 Enzymes [BR:halm01000]  6. Ligases   6.4  Forming carbon-carbon bonds    6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)     6.4.1.2  acetyl-CoA carboxylase      FCF25_04495     6.4.1.3  propionyl-CoA carboxylase      FCF25_04495 SSDB OrthologParalogGFIT Motif Pfam:  PccX Motif Other DBs NCBI-ProteinID:  QCJ48489 LinkDB All DBs Position 902645..902887 Genome browser AA seq 80 aa AA seqDB search MIPADADADEAAAIAAVVGAHLRDQQAAAAAAAASESEETWDGSRWRFAGRVDALQGRTV RVPDGAPTDAWTAAGRTDRF NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtgattcccgccgacgcggatgccgacgaagccgcggccatcgccgccgtcgtcggcgca cacctccgggaccagcaggcggccgcagcggccgccgccgcgtcggagtcagaggagacg tgggacgggagtcggtggcgcttcgccgggcgcgtcgacgcgctgcagggccggaccgtc cgcgtccccgacggcgcgccgaccgacgcgtggaccgccgcgggtcgaaccgaccggttc tga

DBGET integrated database retrieval system