KEGG   Haloprofundus sp. MHR1: FCF25_12625
Entry
FCF25_12625       CDS       T05952                                 
Name
(GenBank) hypothetical protein
  KO
K00339  NADH-quinone oxidoreductase subunit J [EC:7.1.1.2]
Organism
halm  Haloprofundus sp. MHR1
Pathway
halm00190  Oxidative phosphorylation
halm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:halm00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    FCF25_12625
Enzymes [BR:halm01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     FCF25_12625
SSDB
Motif
Pfam: Oxidored_q3 MbhD
Other DBs
NCBI-ProteinID: QCJ47907
LinkDB
Position
complement(2495919..2496179)
AA seq 86 aa
MVYETLAFALFALVTVGCSLGVVLVRDIWHSALLLGGALLSVAVHYVMLQAEFLAAMQIL
VYVGGVLILITFAVMLTRTDPEVSST
NT seq 261 nt   +upstreamnt  +downstreamnt
atggtttatgaaaccctggcgttcgcgctgttcgccctcgtcaccgtgggctgcagcctg
ggcgtcgtcctcgtgcgggacatctggcactccgcactcctgctcgggggcgcgctcttg
agcgtcgcggtgcactacgtgatgctgcaagcggagttccttgcagcgatgcagattctc
gtctacgtgggcggggtcctcatcctcatcacgttcgccgtgatgctcacgcggaccgac
ccggaggtgagtagcacatga

DBGET integrated database retrieval system