Halomonas sp. 1513: BWR19_09910 Help Entry BWR19_09910       CDS       T04761                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism halo  Halomonas sp. 1513 Brite KEGG Orthology (KO) [BR:halo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:halo03032]     BWR19_09910    03036 Chromosome and associated proteins [BR:halo03036]     BWR19_09910    03400 DNA repair and recombination proteins [BR:halo03400]     BWR19_09910 DNA replication proteins [BR:halo03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BWR19_09910 Chromosome and associated proteins [BR:halo03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BWR19_09910 DNA repair and recombination proteins [BR:halo03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BWR19_09910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 HU-CCDC81_euk_2 Barstar HTH_IclR Motif Other DBs NCBI-ProteinID:  APX93222 LinkDB All DBs Position complement(2210693..2210965) Genome browser AA seq 90 aa AA seqDB search MNKSELIEAIAASADIPKAAASRALDAMVDSVTDSLKKGDSVSLVGFGTFTVKERAARTG RNPQTGQPIEISAAKVPSFKAGKALKDSVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaagtccgagctgatcgaagccatcgctgcatctgcagatattcccaaggcggct gctagccgtgcgctggacgccatggtggatagcgtgactgacagcctcaagaagggcgat tccgtttctctggtagggtttggtacctttaccgtcaaggagcgtgctgcgcgtaccggc cgtaatcctcagactggccagccgatcgagatcagtgctgccaaggtgccaagcttcaag gccggcaaggcactcaaggattcggtcaactaa

DBGET integrated database retrieval system