Halomonas sp. 1513: BWR19_11970 Help Entry BWR19_11970       CDS       T04761                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism halo  Halomonas sp. 1513 Pathway halo01100   Metabolic pathways halo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:halo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BWR19_11970    00074 Mycolic acid biosynthesis     BWR19_11970   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BWR19_11970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  APX93592 LinkDB All DBs Position complement(2649442..2649675) Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQNTSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYVNAHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagagcgcgtgaagaaggttgtggccgagcgcctgaacgtcaaggaa gaggacatccagaacacctcctccttcaccgaagacctcggcgccgattcgctggatacc gtcgagctggtgatggcgctcgaagaggaattcgataccgagattcccgacgaagaagcc gagaagatcaccaccgttcaggaagcgatcgactacgtcaacgctcaccagtaa

DBGET integrated database retrieval system