Halarchaeum sp. CBA1220: EFA46_002680 Help Entry EFA46_002680      CDS       T06674                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism halr  Halarchaeum sp. CBA1220 Pathway halr03010   Ribosome Brite KEGG Orthology (KO) [BR:halr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     EFA46_002680   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     EFA46_002680  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:halr03011]     EFA46_002680    04121 Ubiquitin system [BR:halr04121]     EFA46_002680   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:halr04147]     EFA46_002680 Ribosome [BR:halr03011]  Ribosomal proteins   Eukaryotes    Small subunit     EFA46_002680   Archaea     EFA46_002680 Ubiquitin system [BR:halr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    EFA46_002680 Exosome [BR:halr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    EFA46_002680   Exosomal proteins of colorectal cancer cells    EFA46_002680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 FYVE Ribosomal_L37e RUBY_RBDX Rcat_RNF216 Zn_ribbon_RPB9 Zn_ribbon_3 Cas12f1-like_TNB zf-C2H2_FBX41 HypA DZR DUF7479 zf_UBZ Zn_Ribbon_TF DUF5817 Motif Other DBs NCBI-ProteinID:  QLC33156 LinkDB All DBs Position complement(497812..497946) Genome browser AA seq 44 aa AA seqDB search MPRSDYYNDEGELAKEQCPRCGDTFLAEHSDRKHCGKCGYTEWN NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgccccgctcggactactacaacgacgagggcgaactggcgaaggagcagtgtccgcgc tgtggcgacacgttcctcgcggagcactcggaccgcaagcactgcgggaagtgcggctac accgagtggaactga

DBGET integrated database retrieval system