Halarchaeum sp. CBA1220: EFA46_002770 Help Entry EFA46_002770      CDS       T06674                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism halr  Halarchaeum sp. CBA1220 Pathway halr03010   Ribosome Brite KEGG Orthology (KO) [BR:halr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     EFA46_002770   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     EFA46_002770  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:halr03011]     EFA46_002770    04121 Ubiquitin system [BR:halr04121]     EFA46_002770 Ribosome [BR:halr03011]  Ribosomal proteins   Eukaryotes    Large subunit     EFA46_002770   Archaea     EFA46_002770 Ubiquitin system [BR:halr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    EFA46_002770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e DZR DHHC Zn_Ribbon_1 DZR_2 Zn_ribbon_3 Motif Other DBs NCBI-ProteinID:  QLC33174 UniProt:  A0A7D5DXU0 LinkDB All DBs Position complement(513278..513424) Genome browser AA seq 48 aa AA seqDB search MSEQSIEDRLLDKQVCMRCNARNPKEADHCRKCGYNNLRPKARERRAT NT seq 147 nt NT seq  +upstreamnt  +downstreamnt atgtccgagcaatccatcgaggaccggcttctcgacaagcaggtctgcatgcgctgtaac gcgcgcaaccccaaggaggccgaccactgccgcaagtgcggctacaacaatctccgcccg aaggcccgcgaacgccgcgcgacctga

DBGET integrated database retrieval system