Halorarum salinum: HUG12_19490 Help Entry HUG12_19490       CDS       T06744                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism halu  Halorarum salinum Pathway halu03010   Ribosome Brite KEGG Orthology (KO) [BR:halu00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     HUG12_19490   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     HUG12_19490  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:halu03011]     HUG12_19490    04121 Ubiquitin system [BR:halu04121]     HUG12_19490 Ribosome [BR:halu03011]  Ribosomal proteins   Eukaryotes    Large subunit     HUG12_19490   Archaea     HUG12_19490 Ubiquitin system [BR:halu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    HUG12_19490 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 zf-CHY DZR Zn_ribbon_GTF2H2 Ribosomal_L37e HVO_0416 Zn_ribbon_RPAB4 Motif Other DBs NCBI-ProteinID:  QLG63787 UniProt:  A0A7D5LDI4 LinkDB All DBs Position complement(3849655..3849804) Genome browser AA seq 49 aa AA seqDB search MASFDAAERRTLNKMICMRCNARNSERADRCRKCGYSRLRPKAKEPRTA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcgagtttcgacgcggccgaacgccgcaccctgaacaagatgatctgtatgcggtgt aacgcccgtaactcggaacgtgccgaccgctgccgaaagtgcggctactcccgactccgg cccaaggcgaaggaaccccggaccgcataa

DBGET integrated database retrieval system