Halomonas alkalicola: B6N23_07600
Help
Entry
B6N23_07600 CDS
T09267
Symbol
lptF
Name
(GenBank) LPS export ABC transporter permease LptF
KO
K07091
lipopolysaccharide export system permease protein
Organism
halw
Halomonas alkalicola
Pathway
halw02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
halw00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
B6N23_07600 (lptF)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
halw02000
]
B6N23_07600 (lptF)
Transporters [BR:
halw02000
]
ABC transporters, prokaryotic type
ABC-2 type and other transporters
Lipopolysaccharide transporter
B6N23_07600 (lptF)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
LptF_LptG
Motif
Other DBs
NCBI-ProteinID:
WLI74731
UniProt:
A0ABY9H8A8
LinkDB
All DBs
Position
complement(1596486..1597568)
Genome browser
AA seq
360 aa
AA seq
DB search
MIIFRYLTREILLTMAAVAGVLLLVIMGSRFIRYFADAAEGGIPASILGTLMLFHLPGFL
ELILPLAFFLGILLAYGQLYLNSEITVLVACGTSPNKLLKVSLVPATLVAILVGLCSLWL
TPPGALHNAVMLEEQRSRIDFSALAPGRFQEFGSGRTAYMEGLSADGSEMRGVFISERQR
RRDGTPETAVTRAEGGYQTLDPETGSRFLVLADGERYSVDPGRFEAERLEFDTYAVRLSQ
ADGMRELDAPEYATTAALFGDDSTRAQAQLQWRLGLPLMVFILTLLAMPLSRVNPRQGRF
AKLLPAIFLHVAYLSLLLAALDAIGRGALPAVVGMWPIHGAFLALGLVMMMRAQRKGMSG
NT seq
1083 nt
NT seq
+upstream
nt +downstream
nt
atgatcatcttccgttatctgacccgcgagatcctgctgaccatggccgccgtcgccggc
gtgctgctgctggtgatcatgggcagtcgcttcatccgctacttcgccgacgccgccgag
gggggcatcccggcgagcatcctcggcaccctgatgctgttccacctgccgggcttcctc
gagctgatcctgccgctggccttctttctgggcatcctgctcgcctacggccagctctac
ctcaacagcgagatcaccgtgctggtggcctgtggcaccagccccaacaagctgctcaag
gtgagcctggtgccggccaccctggtggcgatcctggtggggctgtgcagcctgtggctg
accccgcccggcgccctgcacaacgccgtgatgctcgaggagcagcgcagccgcatcgac
ttctcggccctggcgccggggcgcttccaggagttcggcagcggccgcaccgcctacatg
gagggcctcagcgccgacggcagcgagatgcgcggcgtcttcatcagcgagcgccagcgg
cgccgggacggcaccccggagacggcggtgactcgcgcggaggggggctaccagaccctc
gatcccgagaccggcagccgcttcctggtgctggccgatggcgagcgctacagcgtcgat
ccggggcgcttcgaggcggaacgtctcgagttcgacacctacgcggtgcgcctctcccag
gccgacggcatgcgcgagctcgacgcccccgagtacgccaccaccgcggcgctgttcggc
gacgactcgacccgcgcccaggcccagctgcagtggcgcctggggctgccgctgatggtc
ttcatcctgaccctgctggcgatgccgctctcccgggtcaatccgcgccaggggcgcttc
gccaagctgctgccggcgatcttcctgcacgtggcctacctgagcctgctgctggcggcg
ctggatgccatcggccgcggcgccctgccggccgtggtgggcatgtggccgatccacggc
gccttcctggccctgggcctggtgatgatgatgcgcgcccaacgcaaggggatgagcgga
tga
DBGET
integrated database retrieval system