Halorussus limi: M0R89_04305 Help Entry M0R89_04305       CDS       T08097                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism halx  Halorussus limi Pathway halx03010   Ribosome Brite KEGG Orthology (KO) [BR:halx00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     M0R89_04305   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     M0R89_04305  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:halx03011]     M0R89_04305    04121 Ubiquitin system [BR:halx04121]     M0R89_04305   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:halx04147]     M0R89_04305 Ribosome [BR:halx03011]  Ribosomal proteins   Eukaryotes    Small subunit     M0R89_04305   Archaea     M0R89_04305 Ubiquitin system [BR:halx04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    M0R89_04305 Exosome [BR:halx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    M0R89_04305   Exosomal proteins of colorectal cancer cells    M0R89_04305 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 FYVE Zn_ribbon_RPAB4 zf-C2H2_ZN142 HypA Motif Other DBs NCBI-ProteinID:  UPV75293 UniProt:  A0A8U0HWY8 LinkDB All DBs Position 820002..820136 Genome browser AA seq 44 aa AA seqDB search MARNEYYNDDGTTDKEQCTRCGDAFLADHDDRLHCGRCGYTEWK NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcgcgcaacgagtactacaacgacgacggcacgaccgacaaagagcagtgtacccgg tgtggggacgccttcctcgccgaccacgacgaccgcctccactgcggtcgctgtggctac accgagtggaagtag

DBGET integrated database retrieval system