Halorussus limi: M0R89_05220 Help Entry M0R89_05220       CDS       T08097                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism halx  Halorussus limi Pathway halx03010   Ribosome Brite KEGG Orthology (KO) [BR:halx00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     M0R89_05220   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     M0R89_05220  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:halx03011]     M0R89_05220    04121 Ubiquitin system [BR:halx04121]     M0R89_05220 Ribosome [BR:halx03011]  Ribosomal proteins   Eukaryotes    Large subunit     M0R89_05220   Archaea     M0R89_05220 Ubiquitin system [BR:halx04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    M0R89_05220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e DZR zf-CHY Ribosomal_L37e DZR_2 Zn_Ribbon_1 Zn_ribbon_RPAB4 Motif Other DBs NCBI-ProteinID:  UPV75469 UniProt:  A0A8U0HX99 LinkDB All DBs Position 1013283..1013432 Genome browser AA seq 49 aa AA seqDB search MASFEKAEARILDKMICMRCNARNPHEADNCRKCGYGKLRPKSKEPRNA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggccagcttcgagaaagcggaagcgcgaatcctcgacaagatgatttgcatgcggtgc aacgctcgtaacccccacgaagccgacaactgccgcaagtgcggctacggaaagctccga cccaagagcaaggaaccgcgcaacgcctga

DBGET integrated database retrieval system