Natrinema halophilum: HYG82_11140
Help
Entry
HYG82_11140 CDS
T06745
Name
(GenBank) MFS transporter
Organism
haly
Natrinema halophilum
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MFS_1
MFS_1_like
OATP
LacY_symp
Motif
Other DBs
NCBI-ProteinID:
QLG49377
UniProt:
A0A7D5KRJ1
LinkDB
All DBs
Position
complement(2309463..2310701)
Genome browser
AA seq
412 aa
AA seq
DB search
MTERMNRRRAYGAVVLATLSYTCLMFIWFTLPAHLSTIIDDLGLSSTEAGIVAGAIPLTY
IPVALFSGVIVDRFGPGRSLAAGVLIYGVAQVGRSSASGFPSLLAWTLLIGVGATAITFG
LPKLISVLFPPTETGFPSSIYLVGASAGTASAFAIGRPILTPLLGSWRTLFLWSGAVAIG
YGLCWFVIARRLRIDARNRASNEADAADSSLTLEAIRRDLTLVLTHRELQLVVVIGTMYL
LIAHGMQGWLPTLLEARGYSADRAGRTTSLLVAANITGVLTVPVVADRFSVRRTALLTCG
LVAALGVSGVLTSGIGLLLIGSIVVTGFGVGGLSPLVRAIPPDLEGIGARLTGTAVGFIF
AVGEIGGFLGPVLVGTLRDVTGSYAPGLLVLASGGLVVAVAGGVLRYQYGDG
NT seq
1239 nt
NT seq
+upstream
nt +downstream
nt
atgacggaacggatgaatcgacgacgcgcgtacggcgccgtcgtcctcgcgacgctttcg
tatacgtgtttgatgtttatctggttcacgctgccggctcacctctcgacgattatcgac
gacctcggattgtcgagtaccgaggccggtattgttgcgggtgcgatcccgttaacttac
atcccggttgcgctgttttcgggagtgatcgtcgacaggttcgggccgggtcggagcctc
gcggccggcgttctgatctacggcgtcgcccaggtgggtcgtagctccgcatcgggcttt
ccgtccctgctcgcgtggacgctgctgatcggcgtcggcgccaccgccatcaccttcgga
ttaccgaagctaatctctgtgttgttcccgcccacggagaccgggtttccgtcgtcgatc
tacctcgtcggcgcgtccgcaggcacggctagcgccttcgctatcggtcgcccgatcctc
actccactgctcggtagctggcggacgctctttctttggagtggcgcggttgcgatcggc
tacggtctctgctggttcgtcatcgctcggcggctgcgcatcgacgctcgcaaccgtgcg
tcaaacgaggccgacgcggcggattcgtcactcacgctcgaggcgattcgacgggacctc
acgctcgtactcacccaccgcgaactccagctcgtggtcgtcatcggcacgatgtacctg
ctgatcgctcacgggatgcaaggatggcttccgacgctactcgaggcccgcgggtattcg
gcggatcgagccggccggacgaccagcctgctcgttgcggccaacatcaccggtgtcctc
accgttccggtggtcgcggaccgcttcagcgtacgtcgaacggctctgctcacgtgcggt
ctggtggccgctcttggcgtttcgggcgtgctcaccagcggaatcggcctcctactcatc
ggtagcatcgtcgtcaccgggttcggtgtcggcggcctctctcctctcgtccgtgccatc
ccgccggatctcgagggaatcggcgcgcggttgacagggacggcagtcgggttcattttt
gccgtcggcgaaataggaggattcctcggcccggtactcgtcgggacgttgcgcgacgtc
accggatcgtacgcccctggcctcctcgttctggcttcgggggggctcgtcgtcgcggtg
gcggggggtgttctacggtatcagtacggtgacggctag
DBGET
integrated database retrieval system