Halomicrobium mukohataei JP60: E5139_09035 Help Entry E5139_09035       CDS       T05947                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism halz  Halomicrobium mukohataei JP60 Pathway halz03010   Ribosome Brite KEGG Orthology (KO) [BR:halz00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     E5139_09035   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     E5139_09035  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:halz03011]     E5139_09035    04121 Ubiquitin system [BR:halz04121]     E5139_09035   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:halz04147]     E5139_09035 Ribosome [BR:halz03011]  Ribosomal proteins   Eukaryotes    Small subunit     E5139_09035   Archaea     E5139_09035 Ubiquitin system [BR:halz04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    E5139_09035 Exosome [BR:halz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    E5139_09035   Exosomal proteins of colorectal cancer cells    E5139_09035 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 FYVE Zn_ribbon_RPB9 Ribosomal_L37e DUF7479 Zn_ribbon_3 DZR_2 CHP02642 zf-C2H2_FBX41 Cas12f1-like_TNB Zn_Ribbon_TF DZR zf-C2H2_ZN142 HypA DUF5817 Zn-ribbon_GIR1 Motif Other DBs NCBI-ProteinID:  QCD65768 UniProt:  A0A4D6KB88 LinkDB All DBs Position 1758466..1758600 Genome browser AA seq 44 aa AA seqDB search MARHEYYSDDGQIEREQCPRCGDTFLAEHDDRKHCGKCGYTEWE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcccgtcacgagtactacagcgacgacggtcagatcgaacgcgagcagtgcccccgg tgtggcgacaccttcctcgccgagcacgacgaccgcaaacactgcggcaagtgcggctac accgagtgggagtaa

DBGET integrated database retrieval system