Halomonas sp. MCCC 1A13316: HNO52_07820 Help Entry HNO52_07820       CDS       T10913                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hamc  Halomonas sp. MCCC 1A13316 Pathway hamc01100   Metabolic pathways hamc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hamc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HNO52_07820 (acpP)    00074 Mycolic acid biosynthesis     HNO52_07820 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HNO52_07820 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  QOR38424 UniProt:  A0A7M1Q9V6 LinkDB All DBs Position 1677510..1677743 Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQNSSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYVNAHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtgaagaaggttgtggccgagcgcctgaatgtcaaggaa gaggatatccagaacagctcctccttcaccgaggaccttggcgctgattccctggatacc gtcgagctggtcatggcgctcgaagaggaattcgataccgaaattcccgatgaggaagcc gagaagatcaccaccgttcaggaagccatcgattacgtcaacgcccatcagtaa

DBGET integrated database retrieval system