KEGG   Homarus americanus (American lobster): 121873431
Entry
121873431         CDS       T07477                                 
Name
(RefSeq) cytochrome P450 306a1-like
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
hame  Homarus americanus (American lobster)
Pathway
hame00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:hame00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    121873431
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hame00199]
    121873431
Enzymes [BR:hame01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     121873431
Cytochrome P450 [BR:hame00199]
 Cytochrome P450, animal type
  CYP306 family
   121873431
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 121873431
NCBI-ProteinID: XP_042232945
LinkDB
Position
Unknown
AA seq 318 aa
MTSTTATTTTTPINATINNNDYKNHDTEDIYDSNDNNHNHDTHDTDYNHGLICSEGDDWR
EHRKFVLGFMRDHGMRTAATRGVMEPKIHAVADLLIQELKETQGAAVNISGKLLHHVGNT
MNQLIFGLTYLEEDPKWRWLRHLLEEGTKLVGVAGPLNFLPWLRFLPRYQRVIKFITENQ
SKTHQEYQKIIDLHEEASLVTSCDDPVDGGAEENVTETTVGGHEANTHQLTEGDGGTASS
PQLPQHIIGAYVKERRLRGTDMGSFTYEQLHHVAADLFGAGSETTITTLKWHLLNMALFP
EAQFKMVSHSETKVKAEI
NT seq 957 nt   +upstreamnt  +downstreamnt
atgacatccacgactgccacgacaactacgacgcccataaatgccacaattaataacaac
gactacaaaaaccacgacaccgaagacatctatgacagcaacgataataaccacaatcac
gacacccacgacaccgactacaaccacgggctgatctgctctgagggagatgactggagg
gagcaccgcaagttcgtcctggggttcatgagggaccacgggatgcggacagctgccact
aggggggtcatggagccgaagatccacgctgtcgctgacctcctcattcaggaattgaaa
gaaactcaaggagcagctgtgaacatctcaggtaagctgctgcaccacgtaggcaacacc
atgaaccagctcatctttggcctcacctacctggaggaggatcccaaatggaggtggttg
agacatcttctggaggaggggactaagctcgtaggtgttgcaggacccctcaatttcctc
ccatggcttaggtttctgccgaggtatcaacgagtgatcaagtttatcacagagaaccag
agtaagacccaccaggagtaccagaagattattgatctccacgaagaggcaagtttagtc
acttcctgcgacgacccagtggacggtggggcggaggagaacgttactgagacaacggtt
ggaggacacgaggctaacacacaccagcttacagaaggtgacggaggaacagcgtcgtca
ccacagctcccacagcacattattggcgcctacgtcaaggaacggcggctgagggggacg
gatatgggctccttcacctacgagcagctgcatcacgtggctgctgacctcttcggtgct
ggttcagagactaccatcaccaccctcaagtggcacctgctcaacatggctctcttcccc
gaggctcagttcaaaatggtgtcacattctgagacgaaggtcaaggctgaaatctga

DBGET integrated database retrieval system