Halobacillus amylolyticus: MUO15_04375 Help Entry MUO15_04375       CDS       T09510                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hamy  Halobacillus amylolyticus Pathway hamy01100   Metabolic pathways hamy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hamy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MUO15_04375 (acpP)    00074 Mycolic acid biosynthesis     MUO15_04375 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MUO15_04375 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Guanylate_cyc ACP_SdgA_C DUF1493 Motif Other DBs NCBI-ProteinID:  UOR12759 UniProt:  A0ABY4HCZ1 LinkDB All DBs Position complement(829235..829468) Genome browser AA seq 77 aa AA seqDB search MADTFDRVKQIIVDRLDADESKVTMEASFKEDLEADSLDVVELVMELEDEFDMEISDEEA EKINTVGDAVNYINSVS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagatacatttgatcgtgtgaaacaaatcattgtcgatcgtctcgatgcagacgaa tctaaagtaacaatggaagcttccttcaaagaagatctagaagcagactcacttgacgtt gtagaattagtaatggagcttgaagatgagtttgatatggaaatttctgatgaagaagct gaaaaaatcaatactgttggcgacgctgtgaactacataaacagtgtatcgtaa

DBGET integrated database retrieval system