Halomonas sp. M1: P8S55_01580 Help Entry P8S55_01580       CDS       T10932                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism hamz  Halomonas sp. M1 Brite KEGG Orthology (KO) [BR:hamz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:hamz03032]     P8S55_01580    03036 Chromosome and associated proteins [BR:hamz03036]     P8S55_01580    03400 DNA repair and recombination proteins [BR:hamz03400]     P8S55_01580 DNA replication proteins [BR:hamz03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     P8S55_01580 Chromosome and associated proteins [BR:hamz03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     P8S55_01580 DNA repair and recombination proteins [BR:hamz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       P8S55_01580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 HU-CCDC81_euk_2 HU-DNA_bdg HTH_IclR Motif Other DBs NCBI-ProteinID:  WFE71789 UniProt:  A0AAX3S9W5 LinkDB All DBs Position 351390..351662 Genome browser AA seq 90 aa AA seqDB search MNKSELIEAIAASADIPKAAATRALDAMVESVTDSLKKGESVSLVGFGTFAIKERAARTG RNPQTGQPIQISAAKVPSFKAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataagtccgagctgattgaagctattgccgcgtctgctgatattcctaaagcagcg gcaacccgcgcattggatgccatggtggagtctgtcaccgatagcctcaaaaaaggcgag agtgtttcactggtaggctttggtactttcgcgattaaagagcgcgctgcacgtacaggc cggaacccacaaacgggtcagccaattcaaatcagcgctgctaaggttcccagctttaaa gccggaaaagcgctgaaagacgccgtcaactaa

DBGET integrated database retrieval system