Halomonas sp. M1: P8S55_03775 Help Entry P8S55_03775       CDS       T10932                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hamz  Halomonas sp. M1 Pathway hamz01100   Metabolic pathways hamz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hamz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P8S55_03775 (acpP)    00074 Mycolic acid biosynthesis     P8S55_03775 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P8S55_03775 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  WFE72214 UniProt:  A0AAX3S8I4 LinkDB All DBs Position complement(839838..840071) Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQNSSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYVNAHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtactattgaagagcgcgtgaagaaagttgtggcagagcgcctaaacgttaaagaa gaagacatccagaatagctcttctttcacggaagacttaggtgccgactccctcgacacc gttgaactggtgatggctttggaagaggaatttgatactgaaattcctgacgaagaagct gaaaaaatcactacggttcaagaagccatcgactacgtaaacgcccaccagtaa

DBGET integrated database retrieval system