Helianthus annuus (common sunflower): 110873724 Help Entry 110873724         CDS       T05101                                  Name (RefSeq) protein MHF2 homolog   KO K15360   centromere protein X Organism han  Helianthus annuus (common sunflower) Pathway han03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:han00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     110873724  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:han03400]     110873724 DNA repair and recombination proteins [BR:han03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      110873724 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-X Motif Other DBs NCBI-GeneID:  110873724 NCBI-ProteinID:  XP_021978419 LinkDB All DBs Position 8:121656893..121661308 Genome browser AA seq 102 aa AA seqDB search METNFDQDVIAAIFKFVWSKKAIDREKIEDGEASKGEERAGTSKKNRPTSANPNAVRLSC ELLRLFVTEAVQRAATIAEAEGGTKIEATHLERILPQLLLDF NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggagaccaattttgatcaggatgtgattgctgccattttcaagttcgtttggagcaag aaggcaatcgatcgggagaagattgaagacggtgaggcttccaaaggcgaggaacgagct ggaacctctaagaaaaaccggcctacttccgccaatccaaatgctgtgaggctgagttgt gaactacttcgactgtttgttacagaagcagtccaacgagctgctactattgcggaagct gaaggcgggaccaagattgaagctactcacctggaaaggatacttcctcagttactgtta gatttttaa

DBGET integrated database retrieval system