Helianthus annuus (common sunflower): 110888129 Help Entry 110888129         CDS       T05101                                  Name (RefSeq) ras-related protein Rab7-like   KO K07897   Ras-related protein Rab-7A Organism han  Helianthus annuus (common sunflower) Pathway han04144   Endocytosis han04145   Phagosome han04148   Efferocytosis Brite KEGG Orthology (KO) [BR:han00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     110888129    04145 Phagosome     110888129    04148 Efferocytosis     110888129  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:han04131]     110888129   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:han04147]     110888129    04031 GTP-binding proteins [BR:han04031]     110888129 Membrane trafficking [BR:han04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     110888129 Exosome [BR:han04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110888129   Exosomal proteins of other body fluids (saliva and urine)    110888129   Exosomal proteins of colorectal cancer cells    110888129   Exosomal proteins of bladder cancer cells    110888129 GTP-binding proteins [BR:han04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     110888129 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA Motif Other DBs NCBI-GeneID:  110888129 NCBI-ProteinID:  XP_035835767 LinkDB All DBs Position 11:complement(45087026..45088617) Genome browser AA seq 129 aa AA seqDB search MNILSDNPLAVVAVDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNVQKSFDNL NNWREEFLIQASPSDPENFPFIVLGNKVDVDGGNSRVVSEKKARAWCAAKGDTPYFETST VAVVAAFSP NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgaacatcctctccgacaaccctctggctgtggtggcggtggacaggctcttcactctg cagatctgggatacagctggacaggaaagatttcagagccttggagttgcgttctaccgc ggtgcggattgctgtgttcttgtgtatgatgtgaacgtgcaaaagtcattcgataatctc aacaattggcgcgaagaattccttattcaggcgagcccttcggatccggagaatttcccc tttatagttttggggaacaaagttgatgtagatggtggtaatagtagagtggtctctgag aagaaggccagggcttggtgtgctgcaaaaggggacactccgtatttcgaaacatccaca gtggctgtggtggcggcgttttctccttaa

DBGET integrated database retrieval system