Helianthus annuus (common sunflower): 110895314 Help Entry 110895314         CDS       T05101                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism han  Helianthus annuus (common sunflower) Pathway han03083   Polycomb repressive complex han04120   Ubiquitin mediated proteolysis han04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:han00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110895314    04120 Ubiquitin mediated proteolysis     110895314   09126 Chromosome    03083 Polycomb repressive complex     110895314  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:han04131]     110895314    04121 Ubiquitin system [BR:han04121]     110895314    03036 Chromosome and associated proteins [BR:han03036]     110895314 Membrane trafficking [BR:han04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     110895314 Ubiquitin system [BR:han04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      110895314    Cul7 complex      110895314 Chromosome and associated proteins [BR:han03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      110895314   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      110895314 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ BTB DUF808 Motif Other DBs NCBI-GeneID:  110895314 NCBI-ProteinID:  XP_021998294 LinkDB All DBs Position 12:77507281..77508880 Genome browser AA seq 155 aa AA seqDB search MSSQKTIVLKSSDGETFEVDEVVALESQTIKHMIEDDCANTTIPLPNVTSKIISKVIEYC KKHVESAKNEDKTAEEDLKSFDSEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcatcgcagaaaaccatcgtcttgaagagctccgacggagaaaccttcgaggtagat gaggttgtggcgttggaatcgcagacgatcaaacacatgatcgaagatgactgcgccaac accaccatccccttacctaatgtcaccagcaagatcatctccaaggttattgagtactgc aagaagcacgtggaatcggccaagaacgaggacaagactgctgaggaggatctgaaatcg tttgattctgagtttgttaaagtggatcaagccaccctttttgacctaattttggctgca aactatctcaacatcaaaagcttactggatctgacctgtcaaacggttgctgacatgatc aagggcaagactcctgaagagattcgcaagacgttcaacatcaagaatgacttcacccct gaggaagaagaggaagtccgccgtgagaatgcatgggcatttgagtaa

DBGET integrated database retrieval system