Helianthus annuus (common sunflower): 110903944 Help Entry 110903944         CDS       T05101                                  Name (RefSeq) sm-like protein LSM36B   KO K12625   U6 snRNA-associated Sm-like protein LSm6 Organism han  Helianthus annuus (common sunflower) Pathway han03018   RNA degradation han03040   Spliceosome Brite KEGG Orthology (KO) [BR:han00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     110903944   09123 Folding, sorting and degradation    03018 RNA degradation     110903944  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:han03019]     110903944    03041 Spliceosome [BR:han03041]     110903944 Messenger RNA biogenesis [BR:han03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      110903944   mRNA degradation factors    5'-3' decay     Lsm complex      110903944 Spliceosome [BR:han03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     110903944 SSDB OrthologParalogGFIT Motif Pfam:  LSM SM-ATX Motif Other DBs NCBI-GeneID:  110903944 NCBI-ProteinID:  XP_022005447 LinkDB All DBs Position 14:136008712..136010916 Genome browser AA seq 95 aa AA seqDB search MSGTEAVAREKGSSTTKTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGYMNIAMEQTE EYVNGQLKNKYGDAFIRGNNVLYISTSKSTLAEGA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgagcggaacagaagccgtagcaagagagaaaggctcatcaacaaccaaaacccctgcc gattttctcaaatccattcgtggcagacctgttgttgtcaaattgaactctggagtcgat tatagaggtatcttggcttgtttggatggatatatgaacatagcaatggagcaaaccgaa gaatatgttaatggacaactaaaaaacaaatacggggatgcgtttattcgagggaacaat gttctttacatcagtacatccaagagtacccttgcagaaggtgcctag

DBGET integrated database retrieval system