Helianthus annuus (common sunflower): 110912812 Help Entry 110912812         CDS       T05101                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism han  Helianthus annuus (common sunflower) Pathway han03083   Polycomb repressive complex han04120   Ubiquitin mediated proteolysis han04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:han00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110912812    04120 Ubiquitin mediated proteolysis     110912812   09126 Chromosome    03083 Polycomb repressive complex     110912812  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:han04131]     110912812    04121 Ubiquitin system [BR:han04121]     110912812    03036 Chromosome and associated proteins [BR:han03036]     110912812 Membrane trafficking [BR:han04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     110912812 Ubiquitin system [BR:han04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      110912812    Cul7 complex      110912812 Chromosome and associated proteins [BR:han03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      110912812   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      110912812 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ ICAM_N Motif Other DBs NCBI-GeneID:  110912812 NCBI-ProteinID:  XP_022013321 LinkDB All DBs Position 15:169107744..169109564 Genome browser AA seq 156 aa AA seqDB search MSSEKTIMLKSSDGETFEIEEVVALESQTIKHMIEDDCANTTIPLPNVTGKIMSMVVEYC KKHVQSTNTKGKTVVDDDLKAFDSEFVNVDQDTLFDLILAANYLNIKSLLDLTCKTVADM VKGKTTKEIRKMFNIKNDFTPEEEEQVRHENEWAFD NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcggaaaagaccatcatgttgaagagctccgacggagaaacgttcgagatagaa gaggtggtggcgttggaatcgcaaacgatcaaacacatgatcgaagatgactgtgcgaac accaccatccctttacctaatgtcaccggtaagatcatgtccatggttgttgagtactgt aagaagcatgtccagtcgacgaataccaaggggaagactgttgttgatgacgatctcaaa gcctttgattctgagtttgtcaatgtcgatcaagacactctctttgatctaattctggct gcaaactatctcaacatcaaaagcttactcgatctgacatgtaaaacggttgctgacatg gtcaagggcaagactaccaaagagattcgcaagatgttcaacatcaagaatgacttcacc cccgaggaagaagaacaagtccgccatgagaatgaatgggcatttgattag

DBGET integrated database retrieval system