Helianthus annuus (common sunflower): 110913551 Help Entry 110913551         CDS       T05101                                  Name (RefSeq) SKP1-like protein 5   KO K03094   S-phase kinase-associated protein 1 Organism han  Helianthus annuus (common sunflower) Pathway han03083   Polycomb repressive complex han04120   Ubiquitin mediated proteolysis han04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:han00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110913551    04120 Ubiquitin mediated proteolysis     110913551   09126 Chromosome    03083 Polycomb repressive complex     110913551  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:han04131]     110913551    04121 Ubiquitin system [BR:han04121]     110913551    03036 Chromosome and associated proteins [BR:han03036]     110913551 Membrane trafficking [BR:han04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     110913551 Ubiquitin system [BR:han04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      110913551    Cul7 complex      110913551 Chromosome and associated proteins [BR:han03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      110913551   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      110913551 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Motif Other DBs NCBI-GeneID:  110913551 NCBI-ProteinID:  XP_022014064 LinkDB All DBs Position 15:33943833..33944294 Genome browser AA seq 153 aa AA seqDB search MAEVNETDQTLTVDPITPNLGDSTSSSQPKSEQTTTVNVAVPIPDVGPQLQLVVEEFILK SGSDDEEVRTTARNDLRDFIEREEIGITTLLVVVKYPHDVKNADLLDAFCERVADLIKDK RVVDVREIFGIVNDFTPEEEHALRDEHPWAFED NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcagaagtcaatgaaactgatcaaaccctcaccgttgatcccataaccccaaaccta ggcgattcaacatcatcatcccaaccaaagtccgaacaaaccaccacagtcaatgttgca gtcccaatccccgatgtgggaccgcaacttcaacttgtggtggaagagtttattctaaaa agcggctcagacgatgaggaagtgcgtacaaccgcgaggaatgatctgagagattttatt gagcgtgaagagatagggattacgacgttgctggttgtggttaagtatcctcatgatgtt aagaatgctgatttgttggatgctttttgtgaaagggtggcagatttgatcaaggacaag agggtggtggatgttagagagatttttggtatagttaatgattttacaccggaggaagaa catgctcttcgtgatgagcatccttgggcttttgaagattag

DBGET integrated database retrieval system