Helianthus annuus (common sunflower): 110943674 Help Entry 110943674         CDS       T05101                                  Name (RefSeq) partner of Y14 and mago-like   KO K14294   partner of Y14 and mago Organism han  Helianthus annuus (common sunflower) Pathway han03013   Nucleocytoplasmic transport han03015   mRNA surveillance pathway Brite KEGG Orthology (KO) [BR:han00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     110943674    03015 mRNA surveillance pathway     110943674  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:han03019]     110943674 Messenger RNA biogenesis [BR:han03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Other transport factors      110943674 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Mago-bind Motif Other DBs NCBI-GeneID:  110943674 NCBI-ProteinID:  XP_035846598 LinkDB All DBs Position 5:135922484..135923072 Genome browser AA seq 110 aa AA seqDB search MVRSGGGEDEAKEMVVELTKTLKEGERLVSPTRRPDETLRKPIPIKAGYTLQDEVAIYKS KGALVYYAPSYDPEVDVSKPKTKSAKRNERKKEKHLLVCHLTFVYVRIVV NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggtgcgcagtggtggaggagaagatgaagccaaagaaatggttgttgagctcaccaaa accctaaaagaaggagaacgactcgttagcccgacccgtagacccgacgaaaccctgcgc aaacccattccgatcaaggctggttacacgcttcaggatgaagtcgccatttacaaatcc aaaggagctctcgtatactatgcccctagttatgatcctgaagtggatgttagtaaaccc aaaaccaaatccgctaagcggaatgagaggaagaaggagaagcatttgctggtctgtcat ctaacctttgtatatgttagaattgttgtgtga

DBGET integrated database retrieval system