Helianthus annuus (common sunflower): 18251003 Help Entry 18251003          CDS       T05101                                  Symbol nad4L, AT66_p24 Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism han  Helianthus annuus (common sunflower) Pathway han00190   Oxidative phosphorylation han01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:han00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     18251003 (nad4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:han03029]     18251003 (nad4L) Enzymes [BR:han01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      18251003 (nad4L) Mitochondrial biogenesis [BR:han03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     18251003 (nad4L) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 DUF1899 Motif Other DBs NCBI-GeneID:  18251003 NCBI-ProteinID:  YP_008999554 UniProt:  W0FGD7 LinkDB All DBs Position MT:complement(28678..28950) Genome browser AA seq 90 aa AA seqDB search MIISISGIRGILLNRRNIPIMSMPIESMLLAVNSNFLVFSVSSDDMMGQSFASLVPTVAA AESAIGLAIFVITFRVRGTIAVESINSIQG NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgatcatctctatttcaggtattcggggaatcctccttaatagacgaaatattcctatt atgtcaatgccaattgaatcaatgttattagctgtgaattcgaactttttggtattttcc gtttcttcggatgatatgatgggtcaatcatttgcttcattggttccaacggtggcagct gcggaatctgctattgggttagccattttcgttattactttccgagtccgaggaactatt gctgtagaatctattaatagcattcaaggttaa

DBGET integrated database retrieval system