Helianthus annuus (common sunflower): 4055670 Help Entry 4055670           CDS       T05101                                  Symbol psbF, HeanCp037 Name (RefSeq) photosystem II protein VI   KO K02708   photosystem II cytochrome b559 subunit beta Organism han  Helianthus annuus (common sunflower) Pathway han00195   Photosynthesis han01100   Metabolic pathways Module han_M00161   Photosystem II han_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:han00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     4055670 (psbF)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:han00194]     4055670 (psbF) Photosynthesis proteins [BR:han00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     4055670 (psbF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_B559 Motif Other DBs NCBI-GeneID:  4055670 NCBI-ProteinID:  YP_588133 UniProt:  Q1KXU3 A0A172W3W3 LinkDB All DBs Position Pltd:complement(63685..63804) Genome browser AA seq 39 aa AA seqDB search MTIDRTYPIFTVRWLAVHGLAVPTVSFLGSISAMQFIQR NT seq 120 nt NT seq  +upstreamnt  +downstreamnt atgaccatagatcgaacctatccaatttttacagtgcgatggttggctgttcacggccta gctgtacctaccgtttcttttttggggtcaatatcagcaatgcagttcatacaacgataa

DBGET integrated database retrieval system