Halobacterium salinarum NRC-34001: LJ422_08230 Help Entry LJ422_08230       CDS       T07949                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hanr  Halobacterium salinarum NRC-34001 Pathway hanr03010   Ribosome Brite KEGG Orthology (KO) [BR:hanr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     LJ422_08230   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     LJ422_08230  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hanr03011]     LJ422_08230    04121 Ubiquitin system [BR:hanr04121]     LJ422_08230   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hanr04147]     LJ422_08230 Ribosome [BR:hanr03011]  Ribosomal proteins   Eukaryotes    Small subunit     LJ422_08230   Archaea     LJ422_08230 Ubiquitin system [BR:hanr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    LJ422_08230 Exosome [BR:hanr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    LJ422_08230   Exosomal proteins of colorectal cancer cells    LJ422_08230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_19 Ribosomal_L37e Zn_ribbon_RPB9 Zn_Ribbon_TF Prok-RING_1 DZR_2 zf-FPG_IleRS FYVE DZR Zn_ribbon_3 Cas12f1-like_TNB zf-C2H2_FBX41 zf_UBZ Motif Other DBs NCBI-ProteinID:  UEB91559 LinkDB All DBs Position complement(1509487..1509621) Genome browser AA seq 44 aa AA seqDB search MARGDYYSDDGTTDKEMCPRCGDTFLAAHDDRQVCGRCGYTEWE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcgcgcggtgactactacagcgacgacggcacgacggacaaggagatgtgcccgcgc tgcggggacacgttcctcgcggcccacgacgaccgccaggtgtgtgggcgctgcgggtac accgagtgggagtaa

DBGET integrated database retrieval system