Halobacterium salinarum NRC-34001: LJ422_08330 Help Entry LJ422_08330       CDS       T07949                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism hanr  Halobacterium salinarum NRC-34001 Pathway hanr03010   Ribosome Brite KEGG Orthology (KO) [BR:hanr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     LJ422_08330   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     LJ422_08330  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hanr03011]     LJ422_08330    04121 Ubiquitin system [BR:hanr04121]     LJ422_08330 Ribosome [BR:hanr03011]  Ribosomal proteins   Eukaryotes    Large subunit     LJ422_08330   Archaea     LJ422_08330 Ubiquitin system [BR:hanr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    LJ422_08330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_Ribbon_1 Ribosomal_L40e DZR UPF0547 DZR_2 DUF6395 Zn_ribbon_3 HypA Zn_ribbon_RPAB4 Zn_ribbon_ZPR1 Zn_ribbon_RPB9 Ribosomal_L37e Motif Other DBs NCBI-ProteinID:  UEB91578 LinkDB All DBs Position 1527901..1528044 Genome browser AA seq 47 aa AA seqDB search MSETIEDRLLNKQVCMRCNARNPTDAESCRKCGYKNLRTKASERRSA NT seq 144 nt NT seq  +upstreamnt  +downstreamnt atgagcgagaccattgaggaccgactgctgaacaagcaggtctgcatgcggtgtaacgca cggaacccgacggacgccgagagctgccggaagtgcgggtacaagaacctccgcacgaag gcctccgagcgtcgctccgcgtaa

DBGET integrated database retrieval system