Halobacterium sp. NMX12-1: ABSL23_14255 Help Entry ABSL23_14255      CDS       T10641                                  Name (GenBank) acc operon protein   KO K22568   acetyl-CoA/propionyl-CoA carboxylase, PccX subunit [EC:6.4.1.2 6.4.1.3] Organism hanx  Halobacterium sp. NMX12-1 Pathway hanx00280   Valine, leucine and isoleucine degradation hanx00630   Glyoxylate and dicarboxylate metabolism hanx00640   Propanoate metabolism hanx01100   Metabolic pathways hanx01110   Biosynthesis of secondary metabolites hanx01120   Microbial metabolism in diverse environments hanx01200   Carbon metabolism Module hanx_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite Enzymes [BR:hanx01000]  6. Ligases   6.4  Forming carbon-carbon bonds    6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)     6.4.1.2  acetyl-CoA carboxylase      ABSL23_14255     6.4.1.3  propionyl-CoA carboxylase      ABSL23_14255 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  XCF16391 UniProt:  A0AAU8CBM6 LinkDB All DBs Position complement(2347282..2347542) Genome browser AA seq 86 aa AA seqDB search MATSDLDISVPDDATEAEAAAIAAAVSAHLARLEAEAAAAEGDEESWDDEKWTFAGRLEA VDGRADRVPDGAPTDPWTAAGRSDRF NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggctaccagcgacctcgacatctccgttcccgacgacgcgaccgaggcggaagccgcc gccatcgcggccgcggtgagcgcccacctcgcgcgcctcgaagccgaagccgcggccgcc gaaggcgacgaagaatcgtgggacgacgagaagtggacgttcgcgggccgcctcgaagcc gtggacgggcgcgcggaccgcgttcccgacggcgcgccgacggacccgtggacagcggcc ggccgcagcgaccgattctga

DBGET integrated database retrieval system