Halothece sp. PCC 7418: PCC7418_0523 Help Entry PCC7418_0523      CDS       T02379                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hao  Halothece sp. PCC 7418 Pathway hao01100   Metabolic pathways hao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hao00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PCC7418_0523    00074 Mycolic acid biosynthesis     PCC7418_0523   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PCC7418_0523 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 RLL Ribosomal_L50 DUF7080 DUF5783 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AFZ42752 UniProt:  K9Y8D3 LinkDB All DBs Position 573022..573273 Genome browser AA seq 83 aa AA seqDB search MNQETFNKVKGIVAQQLEIQDQETIKPESKFAEDLGADSLDVVELVMALEEEFDIEIPDE AAEKIATVQAAVDYIEEKAATPS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaatcaagaaacgtttaacaaagtcaaaggcattgttgctcaacaactcgaaattcaa gatcaagaaaccatcaagcctgaatccaagttcgctgaagatttaggggcagactccctc gatgtcgtggaattagtaatggcgttagaagaagaatttgacatcgaaattcctgatgaa gctgccgaaaaaattgccaccgtccaagcagctgtggactatattgaagaaaaagcagcg actccttcctaa

DBGET integrated database retrieval system