Halothece sp. PCC 7418: PCC7418_2631 Help Entry PCC7418_2631      CDS       T02379                                  Name (GenBank) cytochrome b559, alpha subunit   KO K02707   photosystem II cytochrome b559 subunit alpha Organism hao  Halothece sp. PCC 7418 Pathway hao00195   Photosynthesis hao01100   Metabolic pathways Module hao_M00161   Photosystem II hao_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:hao00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     PCC7418_2631  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:hao00194]     PCC7418_2631 Photosynthesis proteins [BR:hao00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     PCC7418_2631 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_B559a Cytochrom_B559 Motif Other DBs NCBI-ProteinID:  AFZ44772 UniProt:  K9YE64 LinkDB All DBs Position 2857583..2857828 Genome browser AA seq 81 aa AA seqDB search MAGDTGERPFGDIITSVRYWVIHSITIPMLFIAGWLFVQTGLAYDAFGTPRPDEYFTKQR QELPIISDRFQAREEVEEFNK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcaggagatacaggtgaacgtccctttggggatattattactagcgttcggtattgg gtgattcatagcattaccatccccatgttatttatcgcgggttggttatttgtccaaacg ggtttagcctatgatgcgtttggaactccccgccctgatgagtatttcaccaagcaacgt caagaattaccgatcattagtgatcgctttcaagcaagagaagaagtcgaagaatttaat aagtaa

DBGET integrated database retrieval system