Halothece sp. PCC 7418: PCC7418_2632 Help Entry PCC7418_2632      CDS       T02379                                  Name (GenBank) cytochrome b559, beta subunit   KO K02708   photosystem II cytochrome b559 subunit beta Organism hao  Halothece sp. PCC 7418 Pathway hao00195   Photosynthesis hao01100   Metabolic pathways Module hao_M00161   Photosystem II hao_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:hao00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     PCC7418_2632  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:hao00194]     PCC7418_2632 Photosynthesis proteins [BR:hao00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     PCC7418_2632 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_B559 MFS_2 Motif Other DBs NCBI-ProteinID:  AFZ44773 LinkDB All DBs Position 2857853..2857987 Genome browser AA seq 44 aa AA seqDB search MTTNRPNEPVTYPIFTVRWLAVHTLAVPSVFFLGAIAAMQFIQR NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgacgaccaatcgtcccaatgaacccgtaacttatcccatttttaccgtccgttggtta gccgttcataccttagctgtgcctagcgttttctttttaggcgcgatcgcagcgatgcag tttattcaaagatag

DBGET integrated database retrieval system