Herminiimonas arsenicoxydans: HEAR0709 Help Entry HEAR0709          CDS       T00490                                  Name (GenBank) Hypothetical protein   KO K09892   cell division protein ZapB Organism har  Herminiimonas arsenicoxydans Brite KEGG Orthology (KO) [BR:har00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:har03036]     HEAR0709 Chromosome and associated proteins [BR:har03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     HEAR0709 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB CENP-H YabA bZIP_1 Mod_r DUF3450 CENP-F_leu_zip Cnn_1N PilJ DivIC BBS2_hp Spc7 UPF0242 PCRF FUSC Motif Other DBs NCBI-ProteinID:  CAL60903 UniProt:  A4G316 LinkDB All DBs Position 713238..713474 Genome browser AA seq 78 aa AA seqDB search MHNYSDDMISDFHQLSEKISQLADLTQSLRSENADLRIKSIALAAENAELTRRMQEAHER VAALLEKIPAPEPDEEAA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcacaactatagtgacgacatgatttccgacttccaccaactttccgaaaaaatcagc cagctggctgatttgacgcaatcgctgcgcagcgaaaatgcggatttgcgcatcaaatcg attgcgctcgccgccgaaaatgccgaactgacgcgccgcatgcaggaagcgcatgaacgc gttgccgccttgcttgaaaaaattccagcgccagaaccagatgaggaagcagcatga

DBGET integrated database retrieval system