Halococcoides cellulosivorans: HARCEL1_11415 Help Entry HARCEL1_11415     CDS       T05406                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism harc  Halococcoides cellulosivorans Pathway harc03010   Ribosome Brite KEGG Orthology (KO) [BR:harc00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     HARCEL1_11415   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     HARCEL1_11415  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:harc03011]     HARCEL1_11415    04121 Ubiquitin system [BR:harc04121]     HARCEL1_11415   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:harc04147]     HARCEL1_11415 Ribosome [BR:harc03011]  Ribosomal proteins   Eukaryotes    Small subunit     HARCEL1_11415   Archaea     HARCEL1_11415 Ubiquitin system [BR:harc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    HARCEL1_11415 Exosome [BR:harc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    HARCEL1_11415   Exosomal proteins of colorectal cancer cells    HARCEL1_11415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 FYVE Anti-TRAP zf-C2H2_FBX41 Zn_ribbon_RPB9 Zn_Ribbon_TF zf-C2H2_ZN142 DUF5817 Motif Other DBs NCBI-ProteinID:  AWB28267 UniProt:  A0A2R4X3A5 LinkDB All DBs Position complement(2316095..2316229) Genome browser AA seq 44 aa AA seqDB search MAHYELYDDEGQTDNEQCPRCGDTFLADHGDRLHCGACSYTEWQ NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcccactacgaactgtacgacgacgagggccagaccgacaacgagcagtgcccccgc tgtggcgacacgttcctcgctgatcacggcgatcggctccactgtggtgcgtgtagctac accgagtggcagtaa

DBGET integrated database retrieval system