KEGG   Halioxenophilus aromaticivorans: R50071_01640
Entry
R50071_01640      CDS       T10756                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
haro  Halioxenophilus aromaticivorans
Pathway
haro00770  Pantothenate and CoA biosynthesis
haro01100  Metabolic pathways
haro01240  Biosynthesis of cofactors
Module
haro_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:haro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    R50071_01640 (coaD)
Enzymes [BR:haro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     R50071_01640 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: BFM04960
LinkDB
Position
complement(181872..182351)
AA seq 159 aa
MKKVVYPGTFDPITNGHIDLVERACRLFDNVVVAVAASTKKNPLFTLDERVAQVQQVTGH
LDNVSVIGFNILFANLVDQLNANAVVRGLRAVSDFEYEFQLANMNRALSPKMETMFLTPA
EHLSYISSSLVREIASLGGDVSNFVPPLIEQDLRKKFQP
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaagaaagtggtttaccccggtacgttcgacccgatcaccaatggccatattgacctg
gtggaacgagcctgccgcctgtttgataatgtcgtcgttgccgttgccgccagcaccaaa
aaaaatccattgttcacactagatgagcgcgttgcccaagtgcagcaagtcaccggacat
ttggataatgtatcggttattggattcaacattttattcgccaacttagtagaccaactg
aacgccaacgccgtggtacgcggtctacgtgcagtttccgatttcgagtacgaattccaa
ctggccaatatgaaccgtgctttatcgccaaaaatggaaaccatgttcctcactcccgcc
gagcatctgagttatatctcgtcttcgttggtgcgagaaattgcctcgttaggtggtgac
gtcagtaattttgtgccgccgctgatcgagcaggatctgcgcaaaaaattccagccctag

DBGET integrated database retrieval system