Halopseudomonas maritima: HV822_05825 Help Entry HV822_05825       CDS       T08633                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism harr  Halopseudomonas maritima Brite KEGG Orthology (KO) [BR:harr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:harr03036]     HV822_05825 Chromosome and associated proteins [BR:harr03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     HV822_05825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB SOGA1-2-like_CC ToxA_N Motif Other DBs NCBI-ProteinID:  UJJ33342 LinkDB All DBs Position 1271773..1271982 Genome browser AA seq 69 aa AA seqDB search MDDLDIQALTQRISQLIDLCDQLKLQNQHLQAQERLWRDERVQLIEKNDLARQKVEAMIL RLKSLEHDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggacgatttggatatccaggcactgactcagcgtatcagccagttgattgatctgtgc gaccagctgaaactgcagaatcagcacctgcaagcgcaggagcgcctgtggcgcgatgag cgcgtgcagttaattgaaaagaacgatttggcccgccagaaggtcgaagccatgattctg cgactcaaatccctggagcacgactcatga

DBGET integrated database retrieval system