Halomonas sp. 'Soap Lake #7': B2G49_21365 Help Entry B2G49_21365       CDS       T09182                                  Name (GenBank) hypothetical protein   KO K03503   DNA polymerase V [EC:3.4.21.-] Organism haso  Halomonas sp. 'Soap Lake #7' Brite KEGG Orthology (KO) [BR:haso00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:haso01002]     B2G49_21365   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:haso03400]     B2G49_21365 Peptidases and inhibitors [BR:haso01002]  Serine peptidases   Family S24: LexA family    B2G49_21365 DNA repair and recombination proteins [BR:haso03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Y-family DNA polymerases     B2G49_21365 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_S24 Motif Other DBs NCBI-ProteinID:  AQU84909 LinkDB All DBs Position 4688049..4688399 Genome browser AA seq 116 aa AA seqDB search MRVNYLGPAVVGVEHPAMAEMDRRKFPPSCFLVEIGEDARPGGPWMEGDVLVVDEARSFG HADLVVAEVEGEYRLFKAHRVGSRCRLLPTSGGQGCFITAKQYRGVVVRQARCWAV NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgcgagtaaattacttagggccagcagtggtgggcgtggagcacccggcaatggcggag atggacaggcgaaaatttccacccagctgctttctggtggagattggtgaggatgcgcgc ccaggcgggccatggatggagggcgacgtgctggtggtggatgaagcgcgctcgtttggc catgctgatttggtggtggctgaggtggaaggcgagtaccggttattcaaagcccaccgc gtgggtagccgttgccggttgttgccaaccagcggagggcaggggtgttttatcactgct aagcagtatcgaggggtggtggtgaggcaagccaggtgttgggcggtgtag

DBGET integrated database retrieval system