Halorhabdus sp. SVX81: SVXHr_2565 Help Entry SVXHr_2565        CDS       T09281                                  Symbol rps27ae Name (GenBank) Ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hasv  Halorhabdus sp. SVX81 Pathway hasv03010   Ribosome Brite KEGG Orthology (KO) [BR:hasv00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     SVXHr_2565 (rps27ae)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     SVXHr_2565 (rps27ae)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hasv03011]     SVXHr_2565 (rps27ae)    04121 Ubiquitin system [BR:hasv04121]     SVXHr_2565 (rps27ae)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hasv04147]     SVXHr_2565 (rps27ae) Ribosome [BR:hasv03011]  Ribosomal proteins   Eukaryotes    Small subunit     SVXHr_2565 (rps27ae)   Archaea     SVXHr_2565 (rps27ae) Ubiquitin system [BR:hasv04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    SVXHr_2565 (rps27ae) Exosome [BR:hasv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    SVXHr_2565 (rps27ae)   Exosomal proteins of colorectal cancer cells    SVXHr_2565 (rps27ae) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 zf-Tbcl_FmdE Zn_ribbon_RPB9 DZR_2 Zn_ribbon_19 Motif Other DBs NCBI-ProteinID:  WEL18710 LinkDB All DBs Position complement(2579306..2579440) Genome browser AA seq 44 aa AA seqDB search MARHELYGDDGTTDREMCPRCGDAFLADHGDRTHCGRCSYTEWN NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcgcgccacgaactctacggcgacgacggcacgaccgaccgagagatgtgcccgcgg tgtggcgacgcgttcctggccgaccacggcgaccgcacgcactgcggccggtgtagctac accgagtggaactga

DBGET integrated database retrieval system