KEGG   Falsihalocynthiibacter arcticus: RC74_15220
Entry
RC74_15220        CDS       T04275                                 
Name
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
hat  Falsihalocynthiibacter arcticus
Pathway
hat00770  Pantothenate and CoA biosynthesis
hat01100  Metabolic pathways
hat01240  Biosynthesis of cofactors
Module
hat_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:hat00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    RC74_15220
Enzymes [BR:hat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     RC74_15220
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: AML52442
UniProt: A0A126V285
LinkDB
Position
3084298..3084786
AA seq 162 aa
MRIGLYPGTFDPITYGHIDIIRRASALVDRLVIGVAINRDKGPLFDLNERVAMIEAECAP
LAKEVGIEIVVHPFENLLIKCANDVNAQIIVRGLRAVADFEYEYQMVGMNRALDSRIETV
FLMADAKHQAIASKLVKEIARLDGDVSKFVTPAVNAALLAKY
NT seq 489 nt   +upstreamnt  +downstreamnt
atgcggattggtctataccccggaacttttgacccgattacctatgggcatattgatatt
attcgacgtgcaagtgcattggttgatcggctggtcatcggggttgcaatcaaccgcgac
aaggggccgttgtttgacttgaacgaacgggtcgcgatgatcgaggcggaatgcgcgcca
ttggccaaggaggtcggcatcgagattgtggtgcatccgtttgaaaatctgttgattaaa
tgcgcaaatgacgtgaatgcgcagattatagtgcgcggccttcgcgcggtggccgatttt
gaatatgagtatcaaatggtcgggatgaaccgcgccttggacagccgaattgaaacggtc
ttcctgatggcagacgccaaacatcaagcgattgccagcaagctggtgaaagagatcgcg
cggcttgatggcgatgtgagtaaattcgtaacccccgccgtgaatgcggcgttgctggcg
aagtattaa

DBGET integrated database retrieval system