Falsihalocynthiibacter arcticus: RC74_20485 Help Entry RC74_20485        CDS       T04275                                  Name (GenBank) tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism hat  Falsihalocynthiibacter arcticus Pathway hat00362   Benzoate degradation hat00622   Xylene degradation hat01100   Metabolic pathways hat01120   Microbial metabolism in diverse environments hat01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:hat00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     RC74_20485    00622 Xylene degradation     RC74_20485    00621 Dioxin degradation     RC74_20485 Enzymes [BR:hat01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      RC74_20485 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 Bmp Motif Other DBs NCBI-ProteinID:  AML53779 UniProt:  A0A126V7S4 LinkDB All DBs Position complement(4176929..4177138) Genome browser AA seq 69 aa AA seqDB search MNIKITREGGPDGTRPTNEEKAQLIAGVSSLLQDVLNKDPKTTFVVIDEVALEDWGIGEL PVMQYRTKS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt ataaatatcaaaattacccgcgaaggtggtccggatggcacccgtccgaccaacgaagaa aaagcacagttgattgcaggtgtaagcagcttgctacaggacgtgctgaacaaagatcca aagacgacctttgtcgtgattgacgaggttgcgcttgaagattgggggatcggcgagctg ccggtcatgcaatacaggacaaagtcatga

DBGET integrated database retrieval system