Hafnia alvei: AT03_06430 Help Entry AT03_06430        CDS       T03425                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hav  Hafnia alvei Pathway hav01100   Metabolic pathways hav01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hav00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AT03_06430    00074 Mycolic acid biosynthesis     AT03_06430   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AT03_06430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  AIU72064 UniProt:  A0A097QZZ7 LinkDB All DBs Position 1394820..1395071 Genome browser AA seq 83 aa AA seqDB search MSQYDVIYEKVSEMIADAKDLECEDIQADAPLALLSLDSLDYVELIILAKREFGVTLTAE LFIQHPNITLREVCEFIDKESVA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagccagtatgatgttatctatgaaaaagtcagtgagatgattgccgatgccaaagat ttagagtgcgaagatattcaggccgatgcgcctcttgcgcttctttctctagatagtttg gactacgtagaattgattatcttagccaagcgagaatttggtgtgaccttaaccgctgaa ctctttattcagcatccgaatattacgctgcgcgaagtctgtgagtttatcgataaggag tcagtggcctaa

DBGET integrated database retrieval system