Helicoverpa armigera (cotton bollworm): 110375556 Help Entry 110375556         CDS       T05609                                  Name (RefSeq) insulin-related peptide 1   KO K05459   insulin-like growth factor 1 Organism haw  Helicoverpa armigera (cotton bollworm) Pathway haw04068   FoxO signaling pathway haw04081   Hormone signaling haw04150   mTOR signaling pathway haw04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:haw00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     110375556    04150 mTOR signaling pathway     110375556   09133 Signaling molecules and interaction    04081 Hormone signaling     110375556  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     110375556  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:haw04052]     110375556 Cytokines and neuropeptides [BR:haw04052]  Cytokines   Growth factors (RTK binding)    110375556 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  110375556 NCBI-ProteinID:  XP_021189375 LinkDB All DBs Position 11:complement(11334109..11334360) Genome browser AA seq 83 aa AA seqDB search MLKLLVVVSLVLVSADSQAAGGRAVLCGRQLSEAIATLCWPELDKRGWWPPAHHVLAGVR GKRGPVDECCLKACSIDELMGYC NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgttgaagctgctggtagtagtctcgctggtgctggtgagcgcggactcgcaggcggcg ggcgggcgcgccgtgctgtgcggccggcagctgtcggaggcgatcgcgacgctgtgctgg cccgagctggacaagcgcggctggtggccgccggcgcaccacgtgctggctggcgtgcgc ggcaagcgcggcccggtggacgagtgctgcctcaaggcctgctctattgatgaacttatg ggatattgctag

DBGET integrated database retrieval system