KEGG   Helicoverpa armigera (cotton bollworm): 110375721
Entry
110375721         CDS       T05609                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Pathway
haw00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:haw00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    110375721
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:haw00199]
    110375721
Enzymes [BR:haw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     110375721
Cytochrome P450 [BR:haw00199]
 Cytochrome P450, animal type
  CYP306 family
   110375721
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 110375721
NCBI-ProteinID: XP_021189636
LinkDB
Position
Unknown
AA seq 539 aa
MDFFFLWLVTFVAGFWIFKKIQQWQSLPPGPWGLPVVGYLPFLDRHQPHRTLAKLSKEYG
SIYGIGMGSVYAVVLSDHKLVRDAFAKENFSGRAPLYLTHGIMKGNGIICAEGGLWKDQR
KLITTWLKSFGMSKHSVSREKLEKRIASGVYELLENVEKAAGSPMDLTHMLSNSLGNVVN
EIIFGFKFPPEDKTWHWFRQIQEEGCHEMGVAGVVNFLPFIRFISSSTQKTIEVLTRGQA
QTHRLYASIIDRRRKIIGLPSIKEAAYAEHENLFTEHPEGHIKCIKYSKHASNTEEHFFD
PNILIPTDGECVLDNFLLEQKRRFESGDESARYVTDEQMLYLLADMFGAGLDTTSVTLAW
FLLYMALYPEEQELVRKEILSVYPEDGEVDGSQLPHLMAAICETQRIRSIVPVGIPHGCI
EDTYLGNYRIPKGTMVIPLQWAIHMDPDVWENPDEFRPSRFLGDDGSLLKPPEFIPFQTG
KRMCPGDELSRMLACGLVARLFRRRRVRLASDPPSEEEMKGTVGVTLAPPTVSYYCDPI
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggattttttctttttatggctagtcacattcgtcgcgggattttggatctttaaaaaa
atacaacaatggcagagtctacctccggggccttggggcctgccggtcgttggctacttg
ccgttcctcgatcgccatcagccacatagaacattagctaagctctctaaggaatatgga
tctatatatggtatcggtatgggcagtgtttatgctgttgtactgtccgaccacaagcta
gtaagagatgcatttgctaaggaaaacttttctggaagagctccattgtatttgactcac
ggaataatgaaaggaaatggtattatttgcgcagagggaggtctgtggaaagatcaaaga
aagttaattacgacctggctcaaaagtttcggtatgagtaagcacagcgtttcacgcgaa
aagttggaaaaacgaatagcgtcgggcgtctacgaacttttagaaaatgttgagaaggct
gcaggctctccgatggatctcacccatatgttatcgaattctctaggtaatgttgtcaac
gagattatcttcggattcaagtttcctcctgaagacaaaacctggcactggttcagacaa
atacaagaagaaggttgccatgaaatgggcgttgctggtgttgtcaactttttgcctttt
ataaggttcatatcatcatccacacaaaaaacaatagaagtcttaacacgcggccaagct
caaactcacagactatatgccagcatcatagaccgacgtcgtaaaattataggtttgcca
tcaataaaagaggccgcatatgctgaacatgaaaacctctttacggaacacccagaaggc
cacataaaatgtatcaagtacagcaagcatgcttcgaatactgaagagcatttcttcgat
ccgaatatcctgattcctactgacggagaatgcgttcttgataatttccttctagaacag
aagagaaggtttgagagtggtgatgagtctgctcgatacgtgactgatgaacaaatgctg
tatctcttagctgatatgtttggagctggtcttgataccacctctgttacgctggcttgg
ttcctcttgtatatggctctttaccctgaagaacaggagctagttcgaaaggagattcta
tcagtataccccgaagacggggaggtcgacggctctcaactaccgcacctcatggctgct
atttgtgagacccagcgcattcgatcaatagttcccgtcggaattccccacgggtgcatc
gaggatacttacctaggaaactacaggattcctaaaggaacgatggtgataccactgcaa
tgggctatacatatggacccggatgtttgggaaaaccctgatgaatttagaccaagtcgc
ttcttaggtgatgatggaagtcttttgaagccgccggagttcataccttttcagacaggt
aagcgcatgtgtcctggtgacgagctttctcggatgcttgcgtgcggtttagtcgcgcga
ctgtttcgtcgccggcgcgtgcgactggcgtcggacccaccttccgaagaggagatgaaa
ggcaccgttggagtcacccttgcacctccaacagtttcctactattgcgatcctatataa

DBGET integrated database retrieval system