Helicoverpa armigera (cotton bollworm): 135117472 Help Entry 135117472         CDS       T05609                                  Name (RefSeq) insulin-related peptide 1-like   KO K05459   insulin-like growth factor 1 Organism haw  Helicoverpa armigera (cotton bollworm) Pathway haw04068   FoxO signaling pathway haw04081   Hormone signaling haw04150   mTOR signaling pathway haw04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:haw00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     135117472    04150 mTOR signaling pathway     135117472   09133 Signaling molecules and interaction    04081 Hormone signaling     135117472  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     135117472  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:haw04052]     135117472 Cytokines and neuropeptides [BR:haw04052]  Cytokines   Growth factors (RTK binding)    135117472 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  135117472 NCBI-ProteinID:  XP_063892860 LinkDB All DBs Position 11:11335305..11335556 Genome browser AA seq 83 aa AA seqDB search MLKLLVVVSLVLVSADSQAAGGRAVLCGRQLSEAIATLCWPELDKRGWWPPAHHVLAGVR GKRGPVDECCLKACSIDEIMGYC NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgttgaagctgctggtagtagtctcgctggtgctggtgagcgcggactcgcaggcggcg ggcgggcgcgccgtgctgtgcggccggcagctgtcggaggcgatcgcgacgctgtgctgg cccgagctggacaagcgcggctggtggccgccggcgcaccacgtgctggctggcgtgcgc ggcaagcgcggcccggtggacgagtgctgcctcaaggcctgctctattgatgaaattatg ggctattgctag

DBGET integrated database retrieval system